Shanghai Stero R&D Co,. Ltd

testosterone, nandrolone, trenbolone, equipoise, masteron, primobolan, antiestrogen, growth hormone, injection vials, water based suspension, hgh, sarms, prohormones

Home
Products
About Us
Factory Tour
Quality Control
Contact Us
Request A Quote
Home ProductsGrowth Hormone Peptides

2Mg Per Vial Growth Hormone Peptides CJC 1295 White Freeze Dried Powder

Certification
Everything is great and very high quality. I will be in touch with you soon for futher services, Really appreciate your fast shipping and good quality

—— Mr.Carlos

Yes I did it arrived yesterday, and I tried it today for the first time with great results. Thank you.

—— Mr.Benjamin

Just letting you know I received the package today, and thanks for the excellent services, Will be ordering again very soon.

—— Mr.Sergey

Yes I have had no issue with quality of products you provided me with , also all my customers are also happy with quality thank you very much.

—— Mr.Drake

Thanks for stuff, ran a test on myself last night... very happy with quality and would like to order a repeat order, thank you.

—— Mr.Hannon

I'm Online Chat Now

2Mg Per Vial Growth Hormone Peptides CJC 1295 White Freeze Dried Powder

Large Image :  2Mg Per Vial Growth Hormone Peptides CJC 1295 White Freeze Dried Powder

Product Details:

Place of Origin: China
Brand Name: Shanghai Stero
Certification: GMP, BP , HSE , ISO9001 , USP
Model Number: Cjc1295

Payment & Shipping Terms:

Minimum Order Quantity: 1Kit
Price: Negotiation
Packaging Details: foil bag package
Delivery Time: 3-5 days
Payment Terms: L/C, D/A, D/P, T/T, Western Union, MoneyGram, Bitcoin
Supply Ability: 1000Kits Per month
Detailed Product Description
Appearence: White Freeze Dried Powder Usage: Muscle Gain
Blood Test: Over 20 Shelf Life: 1 Years
Specifications: 2Mg/vial, 10vials/kit Class: Peptides Products
Customs Pass: Guaranteed Quality: Top Standard

 

2Mg Per Vial Growth Hormone Peptides Cjc1295 Without Dac Cjc1295 Dac

 

CJC-1295 is a tetrasubstituted 30-amino acid peptide hormone, primarily functioning as a growth hormone releasing hormone (GHRH) analog.

 

Clinical Research was first conducted for CJC-1295 during the mid-2000s. The objective of the peptide was to treat visceral fat deposits in obese AIDS patients, as increased levels of exogenous hgH are presumed to increase lipolysis (fat loss). The clinical research was ultimately successful for most research subjects

 

Sequence H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
Molecular Formula C152H252N44O42
One Letter Sequence Y(d-A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2
Physical Apperance white powder
Form & Formulations Sterile Filtered white lyophilized (freeze-dried)
Stability 2 months at room temperature 24 months from date of receipt, 20 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 3 months, 20 to 70 °C under sterile conditions after reconstitution.
Suitability suitable for cell culture and animal experiment
Purity >98% by RP-HPLC
Storage Store at -20°C. Product is guaranteed 2 years from the date of shipment. Following reconstitution, store at -20°C. We recommend to add a carrier protein (0.1% HSA or BSA) for long term storage.

 

 

 
 
 
Recommended Cjc1295 Dac Dosages

The second most potent fat loss peptide is CJC-1295 DAC since it causes the overall GH level to rise in the body. The most potent being

 

Modified GRF 1-29 Dose per injection: 100mcg Injections per vial: 20 x 100mcg dosages Amount to Inject: If you have used 1ml of water for mixing then a 100mcg dosage = 0.05ml (or 5 units on Insulin Syringe). If you have used 2ml of water for mixing then 100mcg = 0.10ml (or 10 units) and if you have used 3ml of water for mixing, then 100mcg = 0.15ml (or 15 units).

 

CJC-1295 DAC Dose per injection: 2mg Injections per vial: 1 x 2mg dosages Amount to Inject: If you have used 0.5ml of water for mixing then a 2mg dosage = 0.50ml (or 50 units on Insulin Syringe). If you have used 1ml of water then a 2mg dosage = 1ml (or 100 units).

 

 

CJC-1295 DAC Results

 

CJC-1295 has shown some amazing results as a growth hormone releasing hormone (GHRH) analog. In animal studies it has been shown that CJC-1295 with DAC can increase growth hormone and IGF-I secretion and effects, and it can do this in very large amounts. CJC-1295 with DAC Stimulates GH and IGF-1 Secretion, and will keep a steady increase of growth hormone and IGF-1 with no increase in prolactin, leading to intense fat loss, and increases protein synthesis for more muscle growth and repair.

 

 

CJC 1295 AND BODYBUILDING

After adolescent growth is complete, natural secretion of HGH begins to decline and it becomes harder to build lean muscle mass. HGH injections have helped children who were deficient in growth hormone reach a normal size, and in 1985 a synthetic version was created. Since then, countless studies have detailed the changes HGH can have in an adult body including increased muscle mass, and decreased body fat. While some doctors and clinics will sometimes prescribe HGH for the off label uses like bodybuilding, the cost, difficulty, and side effects keep the majority of adults who are GH deficient from getting supplemented. In contrast, research shows that CJC 1295 once a week will increase mean plasma GH concentrations by 2-10 fold for more than 6 days, and increase IGF (Insulin growth factor) concentrations 1.5-3 fold for 9-11 days with no serious adverse effects. For bodybuilders, weekend warriors, and even just moms trying to stay fit, higher levels of growth hormone can feel like a proverbial fountain of youth (but it’s really all about the peptides!).

 

 

Method of administration

 

Mostly, these peptides are sold as lyophilized powder in 2mg containers. Bacteriostatic water should be mixed with the powder in order to reconstitute it. To make the dosage of 100mcg per injection, 2ml bacteriostatic water should be mixed into 2mg of lyophilized powder. This reconstituted mixture should be then injected inside the muscles or under the skin. The mixture should be kept under refrigeration at all times otherwise it will degenerate and will not be effective anymore.

 

 

 

Our Peptides Products List
Peptides Name Specification
CJC-1293 2mg/Vial, 10Vials/kit
CJC-1295 2mg/Vial, 10Vials/kit
CJC-1295 DAC (Drug Affinity Complex) 2mg/Vial, 10Vials/kit
GHRP-2 (Pralmorelin) 10mg/Vial, 10Vials/kit
GHRP-2 (Pralmorelin) 5mg/Vial, 10Vials/kit
GHRP-6 (Growth hormone releasing peptide) 10mg/Vial, 10Vials/kit
GHRP-6 (Growth hormone releasing peptide) 5mg/Vial, 10Vials/kit
Melanotan-1(MT1) 10mg/Vial, 10Vials/kit
Melanotan-2 (MT2) 10mg/Vial, 10Vials/kit
Bremelanotide (PT-141) 5mg/Vial, 10Vials/kit
MGF(mast cell growth factor) 2mg/Vial, 10Vials/kit
PEG-MGF 2mg/Vial, 10Vials/kit
HGH Frag 176-191 2mg/Vial, 10Vials/kit
HGH 99.7% (Red, Yellow, Blue, Green Tops) 10IU/Vial, 10Vials/Kit
KIGTROPIN 10IU/Vial, 10Vials/Kit
JINTROPIN 10IU/Vial, 10Vials/Kit
RIPTROPIN 10IU/Vial, 10Vials/Kit
HYGETROPIN 10IU/Vial, 10Vials/Kit
HYGETROPIN 8IU/Vial, 25Vials/Kit
GETROPIN 10IU/Vial, 10Vials/Kit
ANSOMONE 10IU/Vial, 10Vials/Kit
HCG 5000IU/Vial, 10Vials/Kit
EPO Suspension 3000IU/Vial, 5Vials/Kit
EPO Powder 3000IU/Vial, 5Vials/Kit
HMG 75IU/Vial, 6Vials/Kit
IGF1 Des1-3 1mg/Vial, 10Vials/Kit
IGF1 LR3 0.1mg/Vial, 10Vials/Kit
IGF1 LR3 1mg/Vial, 10Vials/Kit
Oxytocin Acetate; Oxtocin 2mg/Vial, 10Vials/kit
Thymosin β4 Acetate (TB500) 2mg/Vial, 10Vials/kit
Alarelin 2mg/Vial, 10Vials/kit
Hexarelin Acetate 2mg/Vial, 10Vials/kit
Hexarelin Acetate 5mg/Vial, 10Vials/kit
Ipamorelin 2mg/Vial, 10Vials/kit
Ipamorelin 5mg/Vial, 10Vials/kit
Egrifta(Tesamorelin) 2mg/Vial, 10Vials/kit
Leuprorelin Acetate; Leuprolide 2mg/Vial, 10Vials/kit
Sermorelin Acetate 2mg/Vial, 10Vials/kit
Triptorelin Acetate 2mg/Vial, 10Vials/kit
DSIP (Delta sleep-inducing peptide) 2mg/Vial, 10Vials/kit
Gonadorelin 2mg/Vial, 10Vials/kit
Gonadorelin 10mg/Vial, 10Vials/kit
Selank 5mg/Vial, 10Vials/kit
Novolin 30R (Isophane Protamine Biosynthetic Human Insulin Injection) 300iu/Vial, 200Vials/Caton
Adenosine Disodium Triphosphate, Coenzyme A and Insulin for Injection

1500Vials/Caton

 

 

 

 

 

 

 

Our Services To You
 
Fast Delivery Delivery within 24 hours upon receipt of your payment
Quality Quality can be promised. Hot sell to Worldwide
Payment Terms T/T ,Bank Transfer, Western Union, Paypal, Bitcoin and M money Gram Available
Sample Sample available at any time
Tracking your at any time Inform your order's further new situation at any time
Package Professional packing with professional materials
PO boxes Available
Reship we have one full-reship policy

 

 

 

 

Contact Details
Shanghai Stero R&D Co,. Ltd

Contact Person: Will

Send your inquiry directly to us Message not be empty!